PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G1203
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 259aa    MW: 29397.6 Da    PI: 5.6008
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G1203genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++++G g+W++ ++  g+ R++k+c++rw +yl
      Gh_A11G1203 14 KGPWTPEEDQILINYIQLHGHGNWRALPKQAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.91.8e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
      Gh_A11G1203  67 RGNFTREEEDTIINLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.159961IPR017930Myb domain
SuperFamilySSF466891.32E-3110108IPR009057Homeodomain-like
SMARTSM007172.4E-151363IPR001005SANT/Myb domain
PfamPF002492.7E-171461IPR001005SANT/Myb domain
CDDcd001675.95E-121661No hitNo description
PROSITE profilePS5129425.21962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2665117IPR009057Homeodomain-like
SMARTSM007171.6E-1466114IPR001005SANT/Myb domain
PfamPF002492.2E-1567112IPR001005SANT/Myb domain
CDDcd001672.77E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MVRAPCCEKM GLKKGPWTPE EDQILINYIQ LHGHGNWRAL PKQAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF TREEEDTIIN LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLKHSH  120
GSNANNRQPI DPSEDIKREQ QPVTIYSPVS PPQSSSDVST SENNSNSHTF TTNTETNEDV  180
SEIDENFWSE VLSADNSSMA ADFRVVGSDQ YFPSSPPPPL PALETVNGCG SNLYDTDANM  240
DFWYNLFTRA ADLPELPEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5915285e-66JX591528.1 Gossypium hirsutum clone NBRI_GE26674 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490695.11e-158PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH41e-80MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A0B0PV750.0A0A0B0PV75_G
STRINGPOPTR_0002s03960.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-82myb domain protein 14